PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla019999
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MYB
Protein Properties Length: 309aa    MW: 35124.3 Da    PI: 8.3134
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla019999genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
        Cla019999 14 KGLWSPEEDEKLLNYITIHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.51.8e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l+++++  lG++ W+ Ia+ ++ gRt++++k+ w++
        Cla019999  67 RGPFSQQEEDLIIELHSVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.582961IPR017930Myb domain
SuperFamilySSF466895.5E-3012108IPR009057Homeodomain-like
SMARTSM007176.5E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001677.05E-121761No hitNo description
PROSITE profilePS5129424.962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-2665117IPR009057Homeodomain-like
SMARTSM007171.7E-1266114IPR001005SANT/Myb domain
PfamPF002492.9E-1367110IPR001005SANT/Myb domain
CDDcd001673.09E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT IHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGPF SQQEEDLIIE LHSVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLKQKG  120
IDPNTHKPLI EKEIINNNEN NNIITSDDKK TYEKASPIQV VPTNSTTTKP IESSDMSTTT  180
TYNFSNFHQP DDGSNHTGLP IIQNNNNHNN AIPFEAISNL FFPSQNSCVV SHVRPSISLI  240
PSENNAPPIG SSTSQVVVHN NNNNSFLWHP DDQFLQTTSD LMRNDWHHHQ INHRHATLQA  300
GMLGQQTFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818471e-116LN681847.1 Cucumis melo genomic scaffold, anchoredscaffold00003.
GenBankLN7132591e-116LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453024.11e-175PREDICTED: transcription factor MYB86-like
TrEMBLA0A0A0LGL11e-118A0A0A0LGL1_CUCSA; Uncharacterized protein
STRINGGLYMA20G22230.12e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.14e-86myb domain protein 50